ELISA Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK(psaK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Anabaena variabilis (strain ATCC 29413 / PCC 7937) Uniprot NO.:P23317 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AATTPLEWSPTIGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGIILGLHNLGRF Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.8 kDa polypeptide Photosystem I subunit X Gene Names:Name:psaK Ordered Locus Names:Ava_2445 Expression Region:9-86 Sequence Info:fµLl length protein