ELISA Recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A, chloroplastic

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrus pyrifolia (Chinese pear) (Pyrus serotina) Uniprot NO.:P24006 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:RKATGRKSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAmLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLI HAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK Protein Names:Recommended name: Chlorophyll a-b binding protein 1A, chloroplastic Alternative name(s): LHCII type II CAB-1A Short name= LHCP Gene Names: Expression Region:46-278 Sequence Info:fµLl length protein