ELISA Recombinant Pseudomonas sp. Lipase chaperone(lifO)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas sp. (strain KWI-56) Uniprot NO.:P25276 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSREGRAPLARRAVVYGVVGLAAIAGVAMWSGAGWHRATGASGESPEASVAGGSVTAPP QAAVPASTGLPPSLAGSSAPRLPLDAGGHLAKSRAVRDFFDYCLTAQSDLSAAGLDAFVM REIAAQLDGTVAQAEALDVWHRYRAYLDALAKLRDAGAADKSDLGALQLALDQRASIAYR TLGDWSQPFFGAEQWRQRYDLARLKIAQDPTLTDAQKAERLAALEQQMPADERAAQQHID QQRAAIDQIAQLQKSGATPDAMRAQLTQTLGPEAAARVAQMQQDDASWQSRYADYAAQRT QIESAGLSPQDRDAQIAALRQRVFTRPGEAVRAASLDRGAGSAR Protein Names:Recommended name: Lipase chaperone Alternative name(s): Lipase activator protein Lipase foldase Lipase helper protein Lipase modµLator Transcriptional activator act Gene Names:Name:lifO Synonyms:act, lipB Expression Region:1-344 Sequence Info:fµLl length protein