ELISA Recombinant Xenopus laevis Myelin proteolipid protein A(plp1-a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P35801 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGWHDGCIRCMVGVPFASVIATVLCFAGVALFCGCGHEALSGTEKLIETYFSKNYQEYEY LIHVINAFQYVIYGIAIFFFLFGILLLAEGFYTTTAIKHILGEFKPPAIKGGLISTVTGG TPKGRSTRGRQPVHTIELICRCLGKWLGHPDKFVGVTYIITILWILIFACSAVPVYIYFN TWVTCQSIAFPGKTTTSVSTLCSDARMYGVLPWNAFPGKVCGTSLLAICKTSEFQMTFHL FIAAFVGAAATLVALLTYMVGASFNYAVLRVTGRSDRSKF Protein Names:Recommended name: Myelin proteolipid protein A Short name= PLP-A Alternative name(s): Lipophilin-A Gene Names:Name:plp1-a Synonyms:plp1 Expression Region:1-280 Sequence Info:fµLl length protein