ELISA Recombinant Rat Olfactory receptor 1571(Olr1571)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P35899 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LLMCNLCFADICFTSASIPTNLVNIQTKNKVITYEGCISQVYFFILFGVLDNFLLAVMAY DRYVAICHPLHYTVIMNRRLCGLLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCE LNQLVLLACNDTFPNDMVMYFAAVLLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFST CASHLSVVSLFYSTLLGVYLSSSFTQNSHSTARASVMYSVVTPmLNPFIYSLRNKDLMGA LRRLFRRKP Protein Names:Recommended name: Olfactory receptor 1571 Alternative name(s): Putative gustatory receptor PTE58 Testis-expressed odorant receptor mT15r Gene Names:Name:Olr1571 Expression Region:1-249 Sequence Info:fµLl length protein