ELISA Recombinant Saccharomyces cerevisiae Protein GMH1(GMH1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P36125
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSYLPTYSNDLPAGPQGQRRRNNGNENDARQGYGQQSVPMVIRRLFKTPKNLDLETASWE MFHLIFHPRKAYRSIYYQRQTKNQWARDDPSFFIFQIALISLSSIIWSIYNSGFNNDSDM GALSIIGHFFKSLVMMVILDFFIFGFIMATIFYLLLNRSHFKFKSSQNSVVEWAYCFDVH CNSFLIILLCLYFIQFLLLPIINLQNWISLLIGNSLYCFAIGHYFILTFYGYNQLPFLKN LNFILLPTLGLSIIYLISLFGIDLSKKLSFYNY
Protein Names:Recommended name: Protein GMH1 Alternative name(s): GEA1-6 membrane-associated high-copy suppressor protein 1
Gene Names:Name:GMH1 Synonyms:MSG1 Ordered Locus Names:YKR030W
Expression Region:1-273
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.