ELISA Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme(pilD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas putida (Arthrobacter siderocapsµLatus) Uniprot NO.:P36642 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPImLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Alternative name(s): Protein pilD Protein secretion protein XCPA Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name Gene Names:Name:pilD Synonyms:xcpA Expression Region:1-288 Sequence Info:fµLl length protein