Skip to Content

ELISA Recombinant Ralstonia metallidurans Nickel and cobalt resistance protein CnrB(cnrB)

https://www.anagnostics.com/web/image/product.template/151683/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) Uniprot NO.:P37973 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMKNERRSVNWPMIAGVAAVAAAVGFGAAHLPVSEKSPASTQAPEAQKPQSAPVKPGLKE VKIPATYLAAANIAVEPVASAAVGTEILAPATVAALPGSEAVIVSRAAGAVQRVQRRLGD VVKAGDVLALVDSPEAAGMAAERKVAQAKADLARKTYEREASLFQQGVTPRQEMEAAKAA LDVAQAEALRAATVAQSAHLASDGRSVAVVSPIAGKITAQSVTLGAFVAPQAELFRVAGT GAVQVEAAVTAADTSRIVAGSEATILLANGSPLSARVQAVTPTVTGSARVATVVVVPAQP TDRLVVGEGVQVRLRTAVADAAALSVPEDAVQNLDGRDVLFVRTQEGFRPMPVLVGTRSG GSAQILSGVQAGEQVATRNAFLVKAEMNKGGGDEE Protein Names:Recommended name: Nickel and cobalt resistance protein CnrB Gene Names:Name:cnrB Ordered Locus Names:Rmet_6209 ORF Names:RMe0084 Expression Region:1-395 Sequence Info:fµLl length protein

1,752.00 € 1752.0 EUR 1,752.00 €

1,752.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.