ELISA Recombinant Saccharomyces cerevisiae Factor-induced gene 1 protein(FIG1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38224 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVAISMIWFFTKRMPRIFALAFNLISIFLLIFLLIGCYNPSNQSTFLVKYKFDDNSPFYT IIEKSYEKSNTTLGLEEVIIRSGYMGVCIDNIPSQYSSYNNMTTFSNSICYARKNLSSVP LYRDLEIQLSNIASSSSKTQSSVVLNILKLAQLTSVNVIHPYVLMATVILTILMFLFILY VTVPKLPFKLAVNKFLLLLSSTIVLTWGIGAMWTHVGINASYRLVPSSSMNIITVKKGKK AAVMAWFSFAFLLLDSVVLWLIFLRDRKSLKDEIDNVPCAQNRYNNYSSDSSTLHSKV Protein Names:Recommended name: Factor-induced gene 1 protein Gene Names:Name:FIG1 Ordered Locus Names:YBR040W ORF Names:YBR0410 Expression Region:1-298 Sequence Info:fµLl length protein