ELISA Recombinant Saccharomyces cerevisiae Protein RTC2(RTC2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38279 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLIPIILNAKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFN VMGAMMQNLLPTMIILAAYYTLADLILLIQCMWYDKEKKSILQEVKKNVDPVHLPPANPI NETVLQDVFNEYEPLLPRIEEEDSQSYSSLELGRTIVVKERENFFNDFLIVSGVLIAGIL SWYISYCSGLDNGIPKKKPAFEQINLPAQILGYLSAILYLGSRIPQIVLNFKRKSCEGVS FLFFLFACLGNTSFIISVLSASWLIGSAGTLLMDFTVFIQFFLYAKPKYEKILIDN Protein Names:Recommended name: Protein RTC2 Alternative name(s): Restriction of telomere capping protein 2 Gene Names:Name:RTC2 Ordered Locus Names:YBR147W ORF Names:YBR1124 Expression Region:1-296 Sequence Info:fµLl length protein