ELISA Recombinant Saccharomyces cerevisiae Degradation in the endoplasmic reticulum protein 1(DER1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38307 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAVILNLLGDIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSI FDYGAFNWISMINIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGV LLHENLVYYELKKNGNQMNVRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGH VIYYMDDIIGKIYGIDLCKSPYDWFRNTETP Protein Names:Recommended name: Degradation in the endoplasmic reticµLum protein 1 Gene Names:Name:DER1 Ordered Locus Names:YBR201W ORF Names:YBR1413 Expression Region:1-211 Sequence Info:fµLl length protein