ELISA Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 1(VTC1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P40046 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVmLGGLGVGLLNFGDKIGRVS AGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRLK YNDANTKL Protein Names:Recommended name: Vacuolar transporter chaperone 1 Alternative name(s): Negative regµLator of CDC42 protein 1 Phosphate metabolism protein 4 Gene Names:Name:VTC1 Synonyms:NRF1, PHM4 Ordered Locus Names:YER072W Expression Region:2-129 Sequence Info:fµLl length protein