ELISA Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 1(VTC1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P40046
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVmLGGLGVGLLNFGDKIGRVS AGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRLK YNDANTKL
Protein Names:Recommended name: Vacuolar transporter chaperone 1 Alternative name(s): Negative regµLator of CDC42 protein 1 Phosphate metabolism protein 4
Gene Names:Name:VTC1 Synonyms:NRF1, PHM4 Ordered Locus Names:YER072W
Expression Region:2-129
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.