ELISA Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c'(VMA16)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P23968 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWA NLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIV FSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL FVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ Protein Names:Recommended name: V-type proton ATPase subunit c'' Short name= V-ATPase subunit c'' Alternative name(s): V-ATPase 22 kDa proteolipid subunit Vacuolar proton pump c'' subunit Gene Names:Name:VMA16 Synonyms:PPA1 Ordered Locus Names:YHR026W Expression Region:1-213 Sequence Info:fµLl length protein