ELISA Recombinant Vaccinia virus 36 kDa major membrane protein (F5L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Uniprot NO.:P24358 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:IEYDVDDNVHICTHTNVSHINHTSWYYNDKVIALATEDKTSGYISSFIKRVNISLTCLNI SSLRYEDSGTYKGVSHLKDGVIVTTTMNISVKANIIDLTGRVRYLTRNYCEVKIRCEITS FALNGSTTPPHMILGTVDKWKYLPFPTDDYRYVGELKRYISGNPYPTESLALEISSTFNR FTIVKNLNDDEFSCYLFSQNYSFHKmLNVRNICESEWEALNNNNDNSSSMPASHNNLAND LSSMMSQLQNDNDDNNDYSAPMNVDNLIMIVLITmLSIILVIIVVIAAISMYKRSKYRHI DN Protein Names:Recommended name: 36 kDa major membrane protein Gene Names:ORF Names:F5L Expression Region:21-322 Sequence Info:fµLl length protein