Skip to Content

ELISA Recombinant Vigna radiata var. radiata Omega-3 fatty acid desaturase, endoplasmic reticulum(ARG1)

https://www.anagnostics.com/web/image/product.template/160857/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) Uniprot NO.:P32291 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQAQTLQHFGNGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVL VVTALAASAISFNSWFFWPLYWPAQGTMFWALFVLGHDCGHGSFSNSSKLNSFVGHILHS LILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRmLRYSFPFPIFAYPF YLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFmLKLYG VPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTH VIHHLFPQIPHYHLVEATKSAKSVLGKYYREPQKSGPLPFHLLKYLLQSISQDHFVSDTG DIVYYQTDPKLHQDSWTKSK Protein Names:Recommended name: Omega-3 fatty acid desaturase, endoplasmic reticµLum EC= 1.14.19.- Alternative name(s): Indole-3-acetic acid-induced protein ARG1 Gene Names:Name:ARG1 Expression Region:1-380 Sequence Info:fµLl length protein

1,736.00 € 1736.0 EUR 1,736.00 €

1,736.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.