ELISA Recombinant Ustilago maydis C-8 sterol isomerase(ERG2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:P32360 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASHRPRSNKAANGASTSPKRSWIIVSAALVGFCALIAALDSIRSSFYIFDHKAIYKIAS TAVANHPGNATAIFDDVLDNLRADPKLAPYINKNHFSDESEWMFNNAGGAMGSMFIIHAS VTEYLIFFGTPVGTEGHTGRHTADDYFNILTGNQYAFPAGALKAEHYPAGSVHHLRRGTV KQYMMPEDGCWALELAQGWIPPmLPFGLADVLSSTLDLPTFGITVWITAREMVGNLLIGK F Protein Names:Recommended name: C-8 sterol isomerase EC= 5.-.-.- Alternative name(s): Delta-8--delta-7 sterol isomerase Gene Names:Name:ERG2 ORF Names:UM01934 Expression Region:1-241 Sequence Info:fµLl length protein