ELISA Recombinant Ustilago maydis C-8 sterol isomerase(ERG2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)
Uniprot NO.:P32360
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASHRPRSNKAANGASTSPKRSWIIVSAALVGFCALIAALDSIRSSFYIFDHKAIYKIAS TAVANHPGNATAIFDDVLDNLRADPKLAPYINKNHFSDESEWMFNNAGGAMGSMFIIHAS VTEYLIFFGTPVGTEGHTGRHTADDYFNILTGNQYAFPAGALKAEHYPAGSVHHLRRGTV KQYMMPEDGCWALELAQGWIPPmLPFGLADVLSSTLDLPTFGITVWITAREMVGNLLIGK F
Protein Names:Recommended name: C-8 sterol isomerase EC= 5.-.-.- Alternative name(s): Delta-8--delta-7 sterol isomerase
Gene Names:Name:ERG2 ORF Names:UM01934
Expression Region:1-241
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.