ELISA Recombinant Variola virus Protein F9 (C13L, F9L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Variola virus (isolate /India/Ind3/1967) (VARV) (Smallpox virus) Uniprot NO.:P33869 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNTR LSFTLMVESFIEVISLLPEKDRRAIAEEIGIDLNDVPSAVSKLEKNCNAYAEVNNIIDIQ KLNIGECSAPPGQHmLLQIVNTGSAGANCGLQTILKSLNKIYVPPIIENRLPYYDPWFLV GVAIILVIFTVAICSIRRNLALKYRYGTFLYV Protein Names:Recommended name: Protein F9 Gene Names:ORF Names:C13L, F9L Expression Region:1-212 Sequence Info:fµLl length protein