Skip to Content

ELISA Recombinant Ralstonia solanacearum Hypersensitivity response secretion protein hrcU(hrcU)

https://www.anagnostics.com/web/image/product.template/151708/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum) Uniprot NO.:P35652 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDEKTEQPTDKKLEDAHRDGETAKSADLTAAAVLLSGCLLLALTASVFGERWRALLDLA LDVDSSRHPLMTLKQTISHFALQLVLMTLPVGFVFALVAWIATWAQTGVVLSFKPVELKM SAINPASGLKRIFSVRSMIDLVKMIIKGVAVAAAVWKLILILMPSIVGAAYQSVMDIAEI GMTLLVRLLAAGGGLFLILGAADFGIQRWLFIRDHRMSKDEVKREHKNSEGDPHIKGERK KLARELADEAKPKQSVAGAQAVVVNPTHYAVAIRYAPEEYGLPRIIAKGVDDEALALREE AAALGIPIVGNPPLARSLYRVDLYGPVPEPLFETVAEVLAWVGEMGASGTPGAEPQH Protein Names:Recommended name: Hypersensitivity response secretion protein hrcU Gene Names:Name:hrcU Synonyms:hrpN Ordered Locus Names:RSp0864 ORF Names:RS01635 Expression Region:1-357 Sequence Info:fµLl length protein

1,712.00 € 1712.0 EUR 1,712.00 €

1,712.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.