ELISA Recombinant Saccharomyces cerevisiae Endoplasmic reticulum transmembrane protein 1(YET1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P35723 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLYFTTLFLLLTVEMVmLFIFVLPLPFRIRRGIFSTYNQLTAKQQIKTIIFITGCLVGL LFIDSWKRSQIRVSLYHNDNSGSIGSSAVTPIQALASRAYNQRNMYISGFILYFSICIPT VMSIVKRLVKYQGLINEQEKQKLNKPSSNSKKDSNEADSTKLQEELRKKQISLEGLQKQV KNLEKYFDEKNQPGNVAAAEASKKGN Protein Names:Recommended name: Endoplasmic reticµLum transmembrane protein 1 Gene Names:Name:YET1 Ordered Locus Names:YKL065C ORF Names:YKL331 Expression Region:1-206 Sequence Info:fµLl length protein