ELISA Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3(AIM27)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P36039 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLLDDQLKYWVLLPISIVMVLTGVLKQYIMTLITGSSANEAQPRVKLTEWQYLQWAQLLI GNGGNLSSDAFAAKKEFLVKDLTEERHLAKAKQQDGSQAGEVPNPFNDPSMSNAMMNMAK GNMASFIPQTIIMWWVNHFFAGFILMQLPFPLTAKFKEmLQTGIICQDLDVRWVSSISWY FISVLGLNPVYNLIGLNDQDMGIQAGIGGPQGPQGPPQSQVDKAMHAMANDLTIIQHETC LDNVEQRVLKQYM Protein Names:Recommended name: ER membrane protein complex subunit 3 Alternative name(s): Altered inheritance rate of mitochondria protein 27 Gene Names:Name:AIM27 Synonyms:EMC3 Ordered Locus Names:YKL207W Expression Region:1-253 Sequence Info:fµLl length protein