ELISA Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23(TVP23)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38962 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV PGFENLSRLANIQSFFQRQ Protein Names:Recommended name: Golgi apparatus membrane protein TVP23 Alternative name(s): TLG2 compartment vesicle protein of 23 kDa Gene Names:Name:TVP23 Ordered Locus Names:YDR084C ORF Names:D4466 Expression Region:1-199 Sequence Info:fµLl length protein