ELISA Recombinant Xenopus laevis Myelin proteolipid protein B(plp1-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P23290 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGWHDGCIRCMVGVPFASVIATVLCFAGVALFCGCGHEALSGTEKLIETYFSKNYQEYEY LIHVINAFQYVIYGIAIFFFLYGILLLAEGFYTTTAIKHILGEFKPPAMKGGLISTVTGG PPKGRSTRGRQPVHTIELICRCLGKWLGHPDKFVGVTYVITILWILIFACSAVPVYIYFN TWVTCQSIAFPGKTTTSVSTLCLDARMYGVLPWNAFPGKVCGTSLLAICKTSEFQMTFHL FIAAFVGAAATLVALLTYMVGASFNYAVLRVTGRSDRSKF Protein Names:Recommended name: Myelin proteolipid protein B Short name= PLP-B Alternative name(s): Lipophilin-B Gene Names:Name:plp1-b Synonyms:plp1 Expression Region:1-280 Sequence Info:fµLl length protein