ELISA Recombinant Rat Type I iodothyronine deiodinase(Dio1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P24389 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLSQLWLWLKRLVIFLQVALEVATGKVLMTLFPERVKQNILAMGQKTGMTRNPRFAPDN WVPTFFSIQYFWFVLKVRWQRLEDRAEYGGLAPNCTVVRLSGQKCNVWDFIQGSRPLVLN FGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQDR LRAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKPGPWNYNPEEV RAVLEKLCIPPGHMPQF Protein Names:Recommended name: Type I iodothyronine deiodinase EC= 1.97.1.10 Alternative name(s): 5DI DIOI Type 1 DI Type-I 5'-deiodinase Gene Names:Name:Dio1 Synonyms:Itdi1, Txdi1 Expression Region:1-257 Sequence Info:fµLl length protein