Skip to Content

ELISA Recombinant Puumala virus Envelope glycoprotein(GP)

https://www.anagnostics.com/web/image/product.template/151417/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Puumala virus (strain Sotkamo/V-2969/81) Uniprot NO.:P27312 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ETQNLNDGWTDTAHGSGIIPMKADLELDFSLPSSASYTYRRQLQNPANEQEKIPFHLQIS KQVIHAEIQHLGHWMDATFNLKTAFHCYGSCEKYAYPWQTAGCFVEKDYEYETGWGCNPP DCPGVGTGCTACGVYLDKLKSVGKVFKIVSLRYTRKVCIQLGTGQTCKTVDSNDCLITTS VKVCLIGTISKFQPSDTLLFLGPLQQGGLIFKQWCTTTCQFGDPGDIMSTPTGMKCPELN GSFRKKCAFATTPVCQFDGNTISGYKRMVATKDSFQSFNVTEPHISTSALEWIDLDSSLR DHINVIVSRDLSFQDLSETPCQVDLTTSATDGAWGSGVGFNLVCTVSLTECSAFLTSIKA CHAAMCYGSTTTNLVRGQNTIHVVGKGGHSGSKFMCCHDTKCSSTGLVAAAPHLDRVTGF NQADSDKIFDDGAPECGMSCWFKKLGEWVLGVLNGNWMVVAVLIALLILSIFLFALCCPR RPSYKKDHKP Protein Names:Recommended name: Envelope glycoprotein Short name= GP Alternative name(s): M polyprotein Cleaved into the following 2 chains: 1. Glycoprotein G1 2. Glycoprotein G2 Gene Names:Name:GP Expression Region:659-1148 Sequence Info:fµLl length protein

1,852.00 € 1852.0 EUR 1,852.00 €

1,852.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.