ELISA Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic(CAP10B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Solanum lycopersicum (Tomato) (Lycopersicon escµLentum) Uniprot NO.:P27525 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGR WAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDN DSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLA EIKHSRLAmLAmLIFYFEAGQGKTPLGALGL Protein Names:Recommended name: Chlorophyll a-b binding protein CP24 10B, chloroplastic Short name= CAB-10B Short name= LHCP Gene Names:Name:CAP10B Expression Region:46-256 Sequence Info:fµLl length protein