ELISA Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2(OST2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P46964
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AKAPKANTPKVTSTSSAVLTDFQETFKTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQ CTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLCNSFPGISKNRAFAEFIVASLIL HFVCLHFIN
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 Short name= Oligosaccharyl transferase subunit OST2 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 16 kDa subunit Oligos
Gene Names:Name:OST2 Ordered Locus Names:YOR103C ORF Names:YOR3211C
Expression Region:2-130
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.