ELISA Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2(OST2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P46964 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKAPKANTPKVTSTSSAVLTDFQETFKTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQ CTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLCNSFPGISKNRAFAEFIVASLIL HFVCLHFIN Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 Short name= Oligosaccharyl transferase subunit OST2 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 16 kDa subunit Oligos Gene Names:Name:OST2 Ordered Locus Names:YOR103C ORF Names:YOR3211C Expression Region:2-130 Sequence Info:fµLl length protein