ELISA Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 55(VPS55)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P47111 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIFLLAPIPNTIFNAGNK YHTSDFMSDSSNTGQDLAHFLTGmLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSS IVIFKWFFKKDFNEDDSLFG Protein Names:Recommended name: Vacuolar protein sorting-associated protein 55 Gene Names:Name:VPS55 Ordered Locus Names:YJR044C ORF Names:J1637 Expression Region:1-140 Sequence Info:fµLl length protein