ELISA Recombinant Rana esculenta Aquaporin FA-CHIP(AQPA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rana escµLenta (Edible frog) (Pelophylax escµLentus) Uniprot NO.:P50501 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASEFKKKAFWRAVIAEFLAMILFVFISIGAALGFNFPIEEKANQTVGRSQDIVKVSLAF GISIATMAQSVGHVSGAHLNPAVTLGCLLSCQISILKAVMYIIAQCLGAVVATAILSGIT SGLENNSLGLNGLSPGVSAGQGLGVEILVTFQLVLCVVAVTDRRRHDVSGSVPLAIGLSV ALGHLIAIDYTGCGMNPARSFGSAVLTKNFTYHWIFWVGPMIGGAAAAIIYDFILAPRTS DLTDRMKVWTNGQVEEYELDGDDNTRVEMKPK Protein Names:Recommended name: Aquaporin FA-CHIP Gene Names:Name:AQPA Expression Region:1-272 Sequence Info:fµLl length protein