ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR038C (YJR038C)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P47106 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTNSRLCPSSPSSSLIKHLTTSGGPSTSLTImLSVIAIRILPAGMRNWIRQALGSLLFA SFLLLSSFHYPITLTLVPVYHESLVKPTSASFGGIRLSQLTMIMERRATPTCQDPSLTEV Protein Names:Recommended name: Putative uncharacterized protein YJR038C Gene Names:Ordered Locus Names:YJR038C ORF Names:J1612 Expression Region:1-120 Sequence Info:fµLl length protein