ELISA Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 2(MOS2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P50087 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTKDFYRQLDPVEEKIVPPENAIVISSEAKEATVNEKEAKQGVLSQRVMKYIGENELVDG ISVRDPDYLKRFFNERRKQFSAKWDKVTNKIDDIAGRYYAREESFTSTIASLHTDPNERL IPGLLSILVASMTGSVLARRRTWLLRATMPIILGSCCFAYAMPTTFRNTMGLIHNLEMNT FPHFTERQDRVWKETKRLSTASVQYYYDAKKWLNKDVEKTGNAIKNWTGVNVK Protein Names:Recommended name: Mitochondrial organizing structure protein 2 Short name= MitOS2 Alternative name(s): Mitochondrial inner membrane organization component of 27 kDa Gene Names:Name:MOS2 Synonyms:MIO27 Ordered Locus Names:YGR235C ORF Names:G8575 Expression Region:1-233 Sequence Info:fµLl length protein