ELISA Recombinant Saccharomyces cerevisiae Rhomboid protein 1, mitochondrial(PCP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P53259 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVP PFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYmLLQKDYVTSKISIIGSAFSH QEFWHLGMNmLALWSFGTSLATmLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSL GASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAH LGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF Protein Names:Recommended name: Rhomboid protein 1, mitochondrial EC= 3.4.21.105 Alternative name(s): Mitochondrial distribution and morphology protein 37 Processing of cytochrome c peroxidase protein 1 Gene Names:Name:PCP1 Synonyms:MDM37, RBD1, µgO2 Ordered Locus Names:YGR101W Expression Region:74-346 Sequence Info:fµLl length protein