ELISA Recombinant Rhizobium sp. Probable ABC transporter permease protein y4oQ (NGR_a02190)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium sp. (strain NGR234) Uniprot NO.:P55602 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTISQTVPRGAVAVRRRRRIRISTVVWFTMPAAAImLLVLGVPLVYSFYYSLTGWSLVVP GSDQDFIGLLNYTDVLRSSEFWAAIRVTLIYAVVAVSLECALGILFAVLLNLEFFGRGLF RSLmLIPMVITPAVVGIFWKLLYEQDSGVFNYLLGTLGFEPVPWLSLTVALASVIIVDVW QSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFRYLTLPHLVPYIMIAAAFRIIGVM ADFDKIFLLTLGGPGNVTTTLSVYAYNTGFKVFDIGRTTAISWIYVVFVLAISAPLIWRL FRGASVNRH Protein Names:Recommended name: Probable ABC transporter permease protein y4oQ Gene Names:Ordered Locus Names:NGR_a02190 ORF Names:y4oQ Expression Region:1-309 Sequence Info:fµLl length protein