ELISA Recombinant Rhizobium sp. Probable conjugal transfer protein trbC(trbC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium sp. (strain NGR234) Uniprot NO.:P55396 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSRKNEFISIALLASPLILASVAPALASSGGSLPWEGPLEQIQESITGPVAGYIALAAVA IAGGmLIFGGELNDFARRLMYVVLVAGILLGATTIVGLFGATGASIGLTNDRATSTRPSA EGEGAHG Protein Names:Recommended name: Probable conjµgal transfer protein trbC Gene Names:Name:trbC Ordered Locus Names:NGR_a04200 ORF Names:y4cN Expression Region:1-127 Sequence Info:fµLl length protein