ELISA Recombinant Rickettsia prowazekii NAD(P) transhydrogenase subunit alpha part 2
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia prowazekii (strain Madrid E)
Uniprot NO.:P51995
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQLPIMAKQAAEIASNAQELSNKLKDLVIDASWQTNTNTIDPLVFAITIFVLASFVGYY VVWKVTPALHTPLMSITNAISGIIVISSMIAITSSSAFEFSSLLGSFATLLASINIFGGF IVTTRmLEMFKK
Protein Names:Recommended name: NAD(P) transhydrogenase subunit alpha part 2 EC= 1.6.1.2 Alternative name(s): Nicotinamide nucleotide transhydrogenase subunit alpha 2 Pyridine nucleotide transhydrogenase subunit alpha 2
Gene Names:Name:pntAB Ordered Locus Names:RP862
Expression Region:1-132
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.