ELISA Recombinant Vibrio harveyi Probable amino-acid ABC transporter permease protein patM(patM)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio harveyi (Beneckea harveyi) Uniprot NO.:P52625 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGFDFNYmLELLPILLKYLGTTMEMATWGLVFSLILSVILANIRVFKLPVLDQLSQLYIS FFRGTPLLVQLFLLYYGLPQIFPFMVGIDAFSAAVIGLTLHFAAYMAESIRAAIIGIDRS QMEASLSVGMTTTQAMRRVILPQATRVALPSLMNYFIDMIKSTSLAFTLGVAEIMAKAQM EASSSFRFFEAFLAVALIYWGVVVILTRVQIWAEAKLNKAYVR Protein Names:Recommended name: Probable amino-acid ABC transporter permease protein patM Gene Names:Name:patM Expression Region:1-223 Sequence Info:fµLl length protein