ELISA Recombinant Pinus thunbergii Chloroplast envelope membrane protein(cemA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pinus thunbergii (Japanese black pine) (Pinus thunbergiana) Uniprot NO.:P52764 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPIPHSITRTLSRFRTELTSESGSLAIHELEVSEYKASASLRYLACLVVLPWVIPISLR KGLEPWVTNWWNTVKSQKIFDYLQEQNALGRFEKIEELFLLERMVEDSLGTHSQSIRIEI HKETIQLVEMYNEDCIQIISHLLTNLIGFAFISAYIILGKNKLAIINSWIQEFFYSLSDT MKAFLILLATDLCIGFHSPHGWELMIDSISESYGFAHNERIISGLVSTFPVILDTILKYW IFRRFNRISPSLVVIYHSMNE Protein Names:Recommended name: Chloroplast envelope membrane protein Gene Names:Name:cemA Synonyms:ycf10 Expression Region:1-261 Sequence Info:fµLl length protein