ELISA Recombinant Salmonella typhimurium Flagellar biosynthetic protein fliP(fliP)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Uniprot NO.:P54700
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFmLRQ TREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLmLFVLVDGWQLLMGSLAQSFYS
Protein Names:Recommended name: Flagellar biosynthetic protein fliP
Gene Names:Name:fliP Synonyms:flaR Ordered Locus Names:STM1979
Expression Region:22-245
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.