ELISA Recombinant Schizosaccharomyces pombe Reticulon-like protein 1(rtn1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P53694 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQHSLNPFESGSVTASDVAAAKSGAEDLVNTLTAHTVHPSTELPSATSFPSALPNSEN PVIQNISSSSSEPHHTSQSTPGETSSPVCPVSGAHGGADKKCPALEAGCPFTNTTKQNVD PEISNALWSVLTWKNTSCSFSTLMSILALVYVPSWINLPRLFFRTFRYVFLITSIIEFGG LFASNGKRGVLSHFRSSYITCDSKALDRIVNSIVDIFNVmLIQFQRILFAESPILTFTAS VAAFIEFFLSGFLSYKSLFVWNVLFAFILPRLYVCNERSIKHLVASLERSGDKLKKQATE TINTTVNK Protein Names:Recommended name: ReticµLon-like protein 1 Alternative name(s): Cell lysis protein cwl1 Gene Names:Name:rtn1 Synonyms:cwl1 ORF Names:SPBC31A8.01c, SPBC651.13c Expression Region:1-308 Sequence Info:fµLl length protein