ELISA Recombinant Thermotoga maritima Uncharacterized protein TM_1467.1 (TM_1467.1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) Uniprot NO.:P58010 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMIDVFLIALLLSILTGNIKNVLKYNYKGLYLFAIPFVLQLLPWKEILVPLSFVmLFLFF IWNRNIPGFKLMAIGAVLNGFTMSVNGGKMPVWEPTLKLLNLDLDFKHTAFTEFSWKTLL ADYIPVYLPWGRKFVISVGDILVFIGVFIFFVLKPRFQTQPSRVPHES Protein Names:Recommended name: Uncharacterized protein TM_1467.1 Gene Names:Ordered Locus Names:TM_1467.1 Expression Region:1-168 Sequence Info:fµLl length protein