ELISA Recombinant Pseudomonas putida Disulfide bond formation protein B 1(dsbB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas putida (strain KT2440) Uniprot NO.:P59345 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNEQTSRLNRERRFLVLLGLICLSLIGGALYMQVVLGEAPCPLCILQRYALLFIAVFAFI AAAMPGRRSLTFFEALVVLSAIGGIVAAGNHVYILANPMVSCGIDTLQPIVDDLPLAKLW PLAFQVDGFCSTPYPPILGLSLAQWALVAFVLTAVLVPLGIYRNRRQA Protein Names:Recommended name: DisµLfide bond formation protein B 1 Alternative name(s): DisµLfide oxidoreductase 1 Gene Names:Name:dsbB1 Ordered Locus Names:PP_0809 Expression Region:1-168 Sequence Info:fµLl length protein