ELISA Recombinant Nostoc sp. Photosystem I reaction center subunit PsaK 1(psaK1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Nostoc sp. (strain PCC 7120 / UTEX 2576) Uniprot NO.:P58583 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGLVLGLHNLGRI Protein Names:Recommended name: Photosystem I reaction center subunit PsaK 1 Alternative name(s): Photosystem I subunit X 1 Gene Names:Name:psaK1 Ordered Locus Names:asr4775 Expression Region:9-86 Sequence Info:fµLl length protein