ELISA Recombinant Vicia faba Aquaporin PIP1.1(PIP1.1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vicia faba (Broad bean) (Faba vµLgaris) Uniprot NO.:P61838 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIAEFIA TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLGA EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL GAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKSRS Protein Names:Recommended name: Aquaporin PIP1.1 Alternative name(s): Plasma membrane aquaporin 1 Short name= Aquaporin 1 Plasma membrane intrinsic protein 1a Short name= PIP1a Gene Names:Name:PIP1.1 Synonyms:AQ1, PIP1A Expression Region:1-286 Sequence Info:fµLl length protein