ELISA Recombinant Rhodopseudomonas palustris Aquaporin Z(aqpZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) Uniprot NO.:P60925 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNTNKYLAEMIGTFWLTFAGCGSAVIAAGFPQVGIGLVGVSLAFGLSVVTMAYAIGHISG CHLNPAVTLGLAAGGRFPVKQIAPYIIAQVLGAIAAAALLYLIASGAAGFDLAKGFASNG YGAHSPGQYNLVACFVMEVVMTMMFLFVIMGSTHGKAPAGFAPLAIGLALVMIHLVSIPV TNTSVNPARSTGPALFVGGWAIGQLWLFWVAPLLGGVLGGVIYRVLSPEPTGVVEGVKAR Protein Names:Recommended name: Aquaporin Z Gene Names:Name:aqpZ Ordered Locus Names:RPA2485 Expression Region:1-240 Sequence Info:fµLl length protein