ELISA Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain(atpP)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) Uniprot NO.:P62021 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAA GIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLmLFGKF Protein Names:Recommended name: Membrane-associated ATPase C chain Alternative name(s): SµL-ATPase proteolipid chain Gene Names:Name:atpP Ordered Locus Names:STK_14390 Expression Region:1-101 Sequence Info:fµLl length protein