ELISA Recombinant Semliki forest virus Structural polyprotein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SemLiki forest virus (SFV) Uniprot NO.:P03315 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT CTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS ASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAF AIGAILVLVVVTCIGLRR Protein Names:Recommended name: Structural polyprotein Alternative name(s): p130 Cleaved into the following 6 chains: 1. Capsid protein EC= 2. 3.4.21.90 Alternative name(s): Coat protein Short name= C p62 Alternative name(s): E3/E2 Gene Names: Expression Region:816-1253 Sequence Info:fµLl length protein