Skip to Content

ELISA Recombinant Zea mays ADP,ATP carrier protein 1, mitochondrial(ANT1)

https://www.anagnostics.com/web/image/product.template/162136/image_1920?unique=7c948e0
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:P04709 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIVDC FKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRG FNISCVGIIVYRGLYFGLYDSIKPVVLTGNLQDNFFASFALGWLITNGAGLASYPIDTVR RRMMMTSGEAVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILF FGKKYGSGGA Protein Names:Recommended name: ADP,ATP carrier protein 1, mitochondrial Alternative name(s): ADP/ATP translocase 1 Adenine nucleotide translocator 1 Short name= ANT 1 Gene Names:Name:ANT1 Synonyms:ANT-G1 Expression Region:78-387 Sequence Info:fµLl length protein

1,662.00 € 1662.0 EUR 1,662.00 €

1,662.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.