Skip to Content

ELISA Recombinant Sendai virus Hemagglutinin-neuraminidase(HN)

https://www.anagnostics.com/web/image/product.template/156660/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sendai virus (strain Z) (SeV) (Sendai virus (strain HVJ)) Uniprot NO.:P04853 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SARQGYSMKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNS RDVIQMIDKSCSRQELTQHCESTIAVHHADGIAPLEPHSFWRCPVGEPYLSSDPEISLLP GPSLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMF PDLNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLK GRTKSHRYRNSEVDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQ QVSQDTCNEALKITWLGGKQVVSVIIQVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLG DRVYIYTRSSGWHSQLQIGVLDVSHPLTINWTPHEALSRPGNKECNWYNKCPKECISGVY TDAYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINmLRIKDVQLEAAYTTTSCITH FGKGYCFHIIEINQKSLNTLQPmLFKTSIPKLCKAES Protein Names:Recommended name: Hemagglutinin-neuraminidase Short name= HN protein EC= 3.2.1.18 Gene Names:Name:HN Expression Region:59-575 Sequence Info:fµLl length protein

1,881.00 € 1881.0 EUR 1,881.00 €

1,881.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.