ELISA Recombinant Vicia faba Apocytochrome f(petA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vicia faba (Broad bean) (Faba vµLgaris) Uniprot NO.:P06669 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAILPDTVFEAVVRIPYDMQVKQV LANGKKGALNVGAVLILPEGFELAPPDRLSPEIKEKIGNLSFQSYRPTKKNIIVIGPVPG KKYSEITFPILSPDPATKRDVYFLKYPIYVGGTRGRGQIYPDGSKSNNNVYNATATGVVN KKIRKEKGGYEITIVDGSDGREVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLLFLASIILAQIFLVLKKKQFEKVQLSEMNF Protein Names:Recommended name: Apocytochrome f Gene Names:Name:petA Expression Region:36-320 Sequence Info:fµLl length protein