ELISA Recombinant Vaccinia virus Protein L2 (VACWR089)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Uniprot NO.:P07613 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEVITDRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQmLLALVALVITLTIFYYFIL Protein Names:Recommended name: Protein L2 Alternative name(s): Protein F3 Gene Names:Ordered Locus Names:VACWR089 ORF Names:L2R Expression Region:1-87 Sequence Info:fµLl length protein