ELISA Recombinant Suid herpesvirus 1 Envelope glycoprotein D

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice)) Uniprot NO.:P07645 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQV DRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTP SADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQH RTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAI DPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPET PHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFR LRGAKGYRLLGGPADADELKAQPGP Protein Names:Recommended name: Envelope glycoprotein D Short name= gD Alternative name(s): Protein gp50 Gene Names: Expression Region:18-402 Sequence Info:fµLl length protein